diff --git a/windows/security/operating-system-security/network-security/windows-firewall/hyper-v-firewall.md b/windows/security/operating-system-security/network-security/windows-firewall/hyper-v-firewall.md
index 33408db506..095663bbb9 100644
--- a/windows/security/operating-system-security/network-security/windows-firewall/hyper-v-firewall.md
+++ b/windows/security/operating-system-security/network-security/windows-firewall/hyper-v-firewall.md
@@ -1,19 +1,22 @@
---
title: Hyper-V firewall
-description: Learn how
+description: Learn how to configure Hyper-V firewall rules and settings using PowerShell or Configuration Service Provider (CSP).
ms.topic: how-to
ms.date: 11/08/2023
+appliesto:
+- ✅ Windows 11
---
-# Configure Hyper-V firewall rules
+# Configure Hyper-V firewall
-Starting in Windows 11, version 22H2, Hyper-V firewall is a network firewall solution that enables filtering of inbound and outbound traffic to/from containers hosted by Windows, including the Windows Subsystem for Linux (WSL).
+Starting in Windows 11, version 22H2, Hyper-V firewall is a network firewall solution that enables filtering of inbound and outbound traffic to/from containers hosted by Windows, including the Windows Subsystem for Linux (WSL).\
+This article describes how to configure Hyper-V firewall rules and settings using PowerShell, configuration service provider (CSP), or group policy (GPO).
-## Configure with PowerShell
+## Configure Hyper-V firewall with PowerShell
This section describes the steps to manage Hyper-V firewall using PowerShell.
-### Obtain the VMCreatorId GUID
+### Obtain the WSL GUID
Hyper-V firewall rules are enabled per *VMCreatorId*. To obtain the VMCreatorId, use the cmdlet:
@@ -21,7 +24,7 @@ Hyper-V firewall rules are enabled per *VMCreatorId*. To obtain the VMCreatorId,
Get-NetFirewallHyperVVMCreator
```
-The output contains a VmCreatorId object, which has *unique identifier* (GUID) and *friendly name* properties. For example, the following output shows WSL:
+The output contains a VmCreator object type, which has unique identifier `VMCreatorId` and `friendly name` properties. For example, the following output shows the properties of WSL:
```powershell
PS C:\> Get-NetFirewallHyperVVMCreator
@@ -29,6 +32,9 @@ VMCreatorId : {40E0AC32-46A5-438A-A0B2-2B479E8F2E90}
FriendlyName : WSL
```
+> [!NOTE]
+> The WSL VMCreatorId is `{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}`.
+
### Verify Hyper-V firewall settings
Hyper-V firewall has settings that apply in general to a VMCreatorId. Use the [Get-NetFirewallHyperVVMSetting][PS-1] cmdlet to check the settings. For example, you can obtain the policies applied to WSL with the command:
@@ -103,29 +109,51 @@ The output contains an extra value compared to the ones described in the previou
>
> To configure these **rules** per profile using the [Set-NetFirewallHyperVRule][PS-4] cmdlet with the `-Profile` option.
-## Configure with Configuration Service Provider (CSP)
+## Configure Hyper-V firewall with CSP
You can configure Hyper-V firewall using the [Firewall CSP][CSP-1]. For example, with an MDM solution like Microsoft Intune.
Here's a list of settings that can be used to configure Hyper-v firewall:
-| | Path |
-|--|--|
-| **CSP** | `./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{VMCreatorId}/`[AllowHostPolicyMerge]
-| **GPO** | Not available |
+|Value name|Description|Values|
+|-|-|-|
+|EnableLoopback
`{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}\HyperVVMSettings\EnableLoopback`|Enables loopback between this guest and another guest or the host.|[True,False]|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}/`[AllowHostPolicyMerge]|Enables Hyper-V firewall to use applicable host firewall settings and rules.|[True,False]|
-| | Path |
-|--|--|
-| **CSP** | `./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{VMCreatorId}/DomainProfile/`[AllowLocalPolicyMerge]
-| **GPO** | Not available |
+The following values apply to Hyper-V firewall profile settings: (Public, Private, Domain)
-| | Path |
-|--|--|
-| **CSP** | `./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{VMCreatorId}/DomainProfile/`[EnableFirewall]
-| **GPO** | Not available |
+|Value name|Description|Values|
+|---|---|---|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}/DomainProfile/`[EnableFirewall]|Enables Hyper-V firewall rules for this profile.|[True, False]|
+|DefaultOutboundAction
`{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}\HyperVVMSettings\\DefaultOutboundAction`|The default action for outbound traffic that is applied if no rules match the traffic.|0 (allow)
1 (block)|
+|DefaultInboundAction
`{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}\HyperVVMSettings\\DefaultInboundAction`|The default action for inbound traffic that is applied if no rules match the traffic.|0 (allow)
1 (block)|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}/DomainProfile/`[AllowLocalPolicyMerge]|||
-
+The following values apply to Hyper-V firewall rules:
+|Value name|Description|Values|
+|---|---|---|
+|Name
`HyperVFirewallRules\\Name`|Friendly name of the rule|String|
+|Priority
`HyperVFirewallRules\\Priority`|Specifies the ordering of rule enforcement. If not specified, block rules are ordered ahead of allow rules. A lower priority rule is evaluated before a higher priority one.|int|
+|Direction
`HyperVFirewallRules\\Direction`|Comma separated list. The rule is enabled based on the traffic direction as following.
IN - the rule applies to inbound traffic.
OUT - the rule applies to outbound traffic.
If not specified the detault is OUT.|String|
+|VMCreatorId
`HyperVFirewallRules\\VMCreatorId`|This field specifies the VM Creator ID that this rule is applicable to. A NULL GUID will result in this rule applying to all VM creators.
Can be filled in automatically from earlier profile?|String (GUID)|
+|Protocol
`HyperVFirewallRules\\Protocol`|0-255 number representing the ip protocol (TCP = 6, UDP = 17). If not specified the default is All.|Int|
+|LocalAddressRanges
`HyperVFirewallRules\\LocalAddressRanges`|Consists of one or more comma-delimited tokens specifying the local addresses covered by the rule. "*" is the default value.
Valid tokens include:
"*" indicates any local address. If present, this must be the only token included.
A subnet can be specified using either the subnet mask or network prefix notation. If neither a subnet mask not a network prefix is specified, the subnet mask defaults to 255.255.255.255.
A valid IPv6 address.
An IPv4 address range in the format of "start address - end address" with no spaces included.
An IPv6 address range in the format of "start address - end address" with no spaces included. If not specified the default is All.|String|
+|LocalPortRanges
`HyperVFirewallRules\\LocalPortRanges`|Comma Separated list of ranges specifying the local port of the traffic covered by this rule. For example, 100-120,200,300-320. If not specified the default is All.|String|
+|RemoteAddressRanges
`HyperVFirewallRules\\RemoteAddressRanges`|Consists of one or more comma-delimited tokens specifying the remote addresses covered by the rule. "*" is the default value.
Valid tokens include:
"*" indicates any remote address. If present, this must be the only token included.
A subnet can be specified using either the subnet mask or network prefix notation. If neither a subnet mask not a network prefix is specified, the subnet mask defaults to 255.255.255.255.
A valid IPv6 address.
An IPv4 address range in the format of "start address - end address" with no spaces included.
An IPv6 address range in the format of "start address - end address" with no spaces included. If not specified the default is All.|String|
+|RemotePortRanges
`HyperVFirewallRules\\RemotePortRanges`|Comma Separated list of ranges specifying the remote port of the traffic covered by this rule. For example, 100-120,200,300-320. If not specified the default is All.|String|
+|Action
`HyperVFirewallRules\\Action`|Specifies the action the rule enforces:
0 - Block
1 - Allow|Int|
+|Enabled
`HyperVFirewallRules\\Enabled`|Indicates whether the rule is enabled or disabled. If the rule must be enabled, this value must be set to true. If not specified - a new rule is disabled by default.|Boolean|
+|Status
`HyperVFirewallRules\\Status`|Provides information about the specific version of the rule in deployment for monitoring purposes.|String|
+|Profiles
`HyperVFirewallRules\\Profiles`|Specifies the profiles to which the rule belongs: Domain, Private, Public. See [FW_PROFILE_TYPE](/openspecs/windows_protocols/ms-fasp/7704e238-174d-4a5e-b809-5f3787dd8acc) for the bitmasks that are used to identify profile types. If not specified, the default is All.|Int|
+
+### :::image type="icon" source="../../../images/icons/feedback.svg" border="false"::: Provide feedback
+
+To provide feedback for Hyper-V firewall, open [**Feedback Hub**][FHUB] and use the category **Security and Privacy > Microsoft Defender Firewall and network protection**.
+
+
+
+[CSP-1]: /windows/client-management/mdm/policy-csp-authentication#enablepasswordlessexperience
[PS-1]: /powershell/module/netsecurity/get-netfirewallhypervvmsetting
[PS-2]: /powershell/module/netsecurity/set-netfirewallhypervvmsetting
[PS-3]: /powershell/module/netsecurity/get-netfirewallhypervrule