diff --git a/windows/security/operating-system-security/network-security/windows-firewall/hyper-v-firewall.md b/windows/security/operating-system-security/network-security/windows-firewall/hyper-v-firewall.md
index 095663bbb9..142d3c1824 100644
--- a/windows/security/operating-system-security/network-security/windows-firewall/hyper-v-firewall.md
+++ b/windows/security/operating-system-security/network-security/windows-firewall/hyper-v-firewall.md
@@ -111,41 +111,41 @@ The output contains an extra value compared to the ones described in the previou
## Configure Hyper-V firewall with CSP
-You can configure Hyper-V firewall using the [Firewall CSP][CSP-1]. For example, with an MDM solution like Microsoft Intune.
+You can configure Hyper-V firewall using the [Firewall CSP][CSP-1], for example with an MDM solution like Microsoft Intune. To learn how to configure Hyper-V firewall with Microsoft Intune, see [ADD LINK][INT-1].
Here's a list of settings that can be used to configure Hyper-v firewall:
-|Value name|Description|Values|
-|-|-|-|
-|EnableLoopback
`{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}\HyperVVMSettings\EnableLoopback`|Enables loopback between this guest and another guest or the host.|[True,False]|
-|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}/`[AllowHostPolicyMerge]|Enables Hyper-V firewall to use applicable host firewall settings and rules.|[True,False]|
+|Value name|Description|
+|-|-|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}/`**[EnableLoopback]**|Enables loopback between this guest and another guest or the host.|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}/`**[AllowHostPolicyMerge]**|Enables Hyper-V firewall to use applicable host firewall settings and rules.|
-The following values apply to Hyper-V firewall profile settings: (Public, Private, Domain)
+The following values apply to Hyper-V firewall profile settings: `Public`, `Private`, `Domain`:
-|Value name|Description|Values|
-|---|---|---|
-|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}/DomainProfile/`[EnableFirewall]|Enables Hyper-V firewall rules for this profile.|[True, False]|
-|DefaultOutboundAction
`{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}\HyperVVMSettings\\DefaultOutboundAction`|The default action for outbound traffic that is applied if no rules match the traffic.|0 (allow)
1 (block)|
-|DefaultInboundAction
`{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}\HyperVVMSettings\\DefaultInboundAction`|The default action for inbound traffic that is applied if no rules match the traffic.|0 (allow)
1 (block)|
-|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}/DomainProfile/`[AllowLocalPolicyMerge]|||
+|Value name|Description|
+|---|---|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}//`**[EnableFirewall]**|Enables Hyper-V firewall rules for this profile.|[True, False]|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}//`**[DefaultOutboundAction]**|The default action for outbound traffic that is applied if no rules match the traffic.|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}//`**[DefaultInboundAction]**|The default action for inbound traffic that is applied if no rules match the traffic.|
+|`./Vendor/MSFT/Firewall/MdmStore/HyperVVMSettings/{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}//`**[AllowLocalPolicyMerge]**|||
The following values apply to Hyper-V firewall rules:
-|Value name|Description|Values|
-|---|---|---|
-|Name
`HyperVFirewallRules\\Name`|Friendly name of the rule|String|
-|Priority
`HyperVFirewallRules\\Priority`|Specifies the ordering of rule enforcement. If not specified, block rules are ordered ahead of allow rules. A lower priority rule is evaluated before a higher priority one.|int|
-|Direction
`HyperVFirewallRules\\Direction`|Comma separated list. The rule is enabled based on the traffic direction as following.
IN - the rule applies to inbound traffic.
OUT - the rule applies to outbound traffic.
If not specified the detault is OUT.|String|
-|VMCreatorId
`HyperVFirewallRules\\VMCreatorId`|This field specifies the VM Creator ID that this rule is applicable to. A NULL GUID will result in this rule applying to all VM creators.
Can be filled in automatically from earlier profile?|String (GUID)|
-|Protocol
`HyperVFirewallRules\\Protocol`|0-255 number representing the ip protocol (TCP = 6, UDP = 17). If not specified the default is All.|Int|
-|LocalAddressRanges
`HyperVFirewallRules\\LocalAddressRanges`|Consists of one or more comma-delimited tokens specifying the local addresses covered by the rule. "*" is the default value.
Valid tokens include:
"*" indicates any local address. If present, this must be the only token included.
A subnet can be specified using either the subnet mask or network prefix notation. If neither a subnet mask not a network prefix is specified, the subnet mask defaults to 255.255.255.255.
A valid IPv6 address.
An IPv4 address range in the format of "start address - end address" with no spaces included.
An IPv6 address range in the format of "start address - end address" with no spaces included. If not specified the default is All.|String|
-|LocalPortRanges
`HyperVFirewallRules\\LocalPortRanges`|Comma Separated list of ranges specifying the local port of the traffic covered by this rule. For example, 100-120,200,300-320. If not specified the default is All.|String|
-|RemoteAddressRanges
`HyperVFirewallRules\\RemoteAddressRanges`|Consists of one or more comma-delimited tokens specifying the remote addresses covered by the rule. "*" is the default value.
Valid tokens include:
"*" indicates any remote address. If present, this must be the only token included.
A subnet can be specified using either the subnet mask or network prefix notation. If neither a subnet mask not a network prefix is specified, the subnet mask defaults to 255.255.255.255.
A valid IPv6 address.
An IPv4 address range in the format of "start address - end address" with no spaces included.
An IPv6 address range in the format of "start address - end address" with no spaces included. If not specified the default is All.|String|
-|RemotePortRanges
`HyperVFirewallRules\\RemotePortRanges`|Comma Separated list of ranges specifying the remote port of the traffic covered by this rule. For example, 100-120,200,300-320. If not specified the default is All.|String|
-|Action
`HyperVFirewallRules\\Action`|Specifies the action the rule enforces:
0 - Block
1 - Allow|Int|
-|Enabled
`HyperVFirewallRules\\Enabled`|Indicates whether the rule is enabled or disabled. If the rule must be enabled, this value must be set to true. If not specified - a new rule is disabled by default.|Boolean|
-|Status
`HyperVFirewallRules\\Status`|Provides information about the specific version of the rule in deployment for monitoring purposes.|String|
-|Profiles
`HyperVFirewallRules\\Profiles`|Specifies the profiles to which the rule belongs: Domain, Private, Public. See [FW_PROFILE_TYPE](/openspecs/windows_protocols/ms-fasp/7704e238-174d-4a5e-b809-5f3787dd8acc) for the bitmasks that are used to identify profile types. If not specified, the default is All.|Int|
+|Value name|Description|
+|---|---|
+|`HyperVFirewallRules\/`**[Name]**|Friendly name of the rule|
+|`HyperVFirewallRules\/`**[Priority]**|Specifies the ordering of rule enforcement. If not specified, block rules are ordered ahead of allow rules. A lower priority rule is evaluated before a higher priority one.|
+|`HyperVFirewallRules\/`**[Direction]**|Comma separated list. The rule is enabled based on the traffic direction as following.
`IN` - the rule applies to inbound traffic.
`OUT` - the rule applies to outbound traffic.
If not specified the detault is OUT.|
+|`HyperVFirewallRules\/`**[VMCreatorId]**|This field specifies the VM Creator ID that this rule is applicable to. A NULL GUID will result in this rule applying to all VM creators.
Can be filled in automatically from earlier profile?|
+|Protocol
`HyperVFirewallRules\/`**[Protocol]**|0-255 number representing the ip protocol (TCP = 6, UDP = 17). If not specified the default is All.|
+|`HyperVFirewallRules\/`**[LocalAddressRanges]**|Consists of one or more comma-delimited tokens specifying the local addresses covered by the rule. "*" is the default value.
Valid tokens include:
"*" indicates any local address. If present, this must be the only token included.
A subnet can be specified using either the subnet mask or network prefix notation. If neither a subnet mask not a network prefix is specified, the subnet mask defaults to 255.255.255.255.
A valid IPv6 address.
An IPv4 address range in the format of "start address - end address" with no spaces included.
An IPv6 address range in the format of "start address - end address" with no spaces included. If not specified the default is All.|
+|`HyperVFirewallRules\/`**[LocalPortRanges]**|Comma Separated list of ranges specifying the local port of the traffic covered by this rule. For example, 100-120,200,300-320. If not specified the default is All.|
+|`HyperVFirewallRules\/`**[RemoteAddressRanges]**|Consists of one or more comma-delimited tokens specifying the remote addresses covered by the rule. "*" is the default value.
Valid tokens include:
"*" indicates any remote address. If present, this must be the only token included.
A subnet can be specified using either the subnet mask or network prefix notation. If neither a subnet mask not a network prefix is specified, the subnet mask defaults to 255.255.255.255.
A valid IPv6 address.
An IPv4 address range in the format of "start address - end address" with no spaces included.
An IPv6 address range in the format of "start address - end address" with no spaces included. If not specified the default is All.|
+|`HyperVFirewallRules\/`**[RemotePortRanges]**|Comma Separated list of ranges specifying the remote port of the traffic covered by this rule. For example, 100-120,200,300-320. If not specified the default is All.|
+|`HyperVFirewallRules\/`**[Action]**|Specifies the action the rule enforces:
0 - Block
1 - Allow|
+|`HyperVFirewallRules\/`**[Enabled]**|Indicates whether the rule is enabled or disabled. If the rule must be enabled, this value must be set to true. If not specified - a new rule is disabled by default.|
+|`HyperVFirewallRules\/`**[Status]**|Provides information about the specific version of the rule in deployment for monitoring purposes.|
+|`HyperVFirewallRules\/`**[Profiles]**|Specifies the profiles to which the rule belongs: Domain, Private, Public. See [FW_PROFILE_TYPE](/openspecs/windows_protocols/ms-fasp/7704e238-174d-4a5e-b809-5f3787dd8acc) for the bitmasks that are used to identify profile types. If not specified, the default is All.|
### :::image type="icon" source="../../../images/icons/feedback.svg" border="false"::: Provide feedback
@@ -153,7 +153,6 @@ To provide feedback for Hyper-V firewall, open [**Feedback Hub**][FHUB] and use
-[CSP-1]: /windows/client-management/mdm/policy-csp-authentication#enablepasswordlessexperience
[PS-1]: /powershell/module/netsecurity/get-netfirewallhypervvmsetting
[PS-2]: /powershell/module/netsecurity/set-netfirewallhypervvmsetting
[PS-3]: /powershell/module/netsecurity/get-netfirewallhypervrule
@@ -162,4 +161,5 @@ To provide feedback for Hyper-V firewall, open [**Feedback Hub**][FHUB] and use
[CSP-1]: /windows/client-management/mdm/firewall-csp
[AllowHostPolicyMerge]: /windows/client-management/mdm/firewall-csp#mdmstorehypervvmsettingsvmcreatoridallowhostpolicymerge
[AllowLocalPolicyMerge]: /windows/client-management/mdm/firewall-csp#mdmstorehypervvmsettingsvmcreatoriddomainprofileallowlocalpolicymerge
-[EnableFirewall]: /windows/client-management/mdm/firewall-csp#mdmstorehypervvmsettingsvmcreatoriddomainprofileenablefirewall
\ No newline at end of file
+[EnableFirewall]: /windows/client-management/mdm/firewall-csp#mdmstorehypervvmsettingsvmcreatoriddomainprofileenablefirewall
+[INT-1]: /windows/client-management/mdm/firewall-csp