mirror of
https://github.com/MicrosoftDocs/windows-itpro-docs.git
synced 2025-05-18 00:07:23 +00:00
144 lines
7.0 KiB
Markdown
144 lines
7.0 KiB
Markdown
---
|
||
title: Hyper-V firewall
|
||
description: Learn how to configure Hyper-V firewall rules and settings using PowerShell or Configuration Service Provider (CSP).
|
||
ms.topic: how-to
|
||
ms.date: 09/06/2024
|
||
appliesto:
|
||
- ✅ <a href="https://learn.microsoft.com/windows/release-health/supported-versions-windows-client" target="_blank">Windows 11</a>
|
||
---
|
||
|
||
# Configure Hyper-V firewall
|
||
|
||
Starting in Windows 11, version 22H2, Hyper-V firewall is a network firewall solution that enables filtering of inbound and outbound traffic to/from containers hosted by Windows, including the Windows Subsystem for Linux (WSL).\
|
||
This article describes how to configure Hyper-V firewall rules and settings using PowerShell or configuration service provider (CSP).
|
||
|
||
> [!IMPORTANT]
|
||
> The configuration of Hyper-V firewall is not available via group policy (GPO). If Windows Firewall settings are configured via GPO and Hyper-V firewall settings aren't configured via CSP, then the applicable rules and settings are automatically mirrored from the GPO configuration.
|
||
|
||
## Configure Hyper-V firewall with PowerShell
|
||
|
||
This section describes the steps to manage Hyper-V firewall using PowerShell.
|
||
|
||
### Obtain the WSL GUID
|
||
|
||
Hyper-V firewall rules are enabled per *VMCreatorId*. To obtain the VMCreatorId, use the cmdlet:
|
||
|
||
```powershell
|
||
Get-NetFirewallHyperVVMCreator
|
||
```
|
||
|
||
The output contains a VmCreator object type, which has unique identifier `VMCreatorId` and `friendly name` properties. For example, the following output shows the properties of WSL:
|
||
|
||
```powershell
|
||
PS C:\> Get-NetFirewallHyperVVMCreator
|
||
VMCreatorId : {40E0AC32-46A5-438A-A0B2-2B479E8F2E90}
|
||
FriendlyName : WSL
|
||
```
|
||
|
||
> [!NOTE]
|
||
> The WSL VMCreatorId is `{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}`.
|
||
|
||
### Verify Hyper-V firewall settings
|
||
|
||
Hyper-V firewall has settings that apply in general to a VMCreatorId. Use the [Get-NetFirewallHyperVVMSetting][PS-1] cmdlet to check the settings. For example, you can obtain the policies applied to WSL with the command:
|
||
|
||
```powershell
|
||
Get-NetFirewallHyperVVMSetting -PolicyStore ActiveStore -Name '{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}'
|
||
```
|
||
|
||
> [!NOTE]
|
||
> `-PolicyStore ActiveStore` returns the *applied* settings.
|
||
|
||
The output contains the following values:
|
||
|
||
| Value | Description |
|
||
|--|--|
|
||
| `Enabled` (True/False) | True if Hyper-V Firewall is enabled for WSL VMs. |
|
||
| `DefaultInboundAction`, `DefaultOutboundAction` | These are default rule policies applied to packets entering or leaving the WSL container. The rule policies can be modified, as described in this article. |
|
||
| `LoopbackEnabled` | Tracks if loopback traffic between the host and the container is allowed, without requiring any Hyper-V Firewall rules. WSL enables it by default, to allow the Windows Host to talk to WSL, and WSL to talk to the Windows Host.|
|
||
| `AllowHostPolicyMerge` | Determines how Windows Host Firewall Enterprise Settings (GPO), Hyper-V Firewall Enterprise Settings (CSP), Windows Host Firewall Enterprise Settings (CSP), local Hyper-V Firewall settings, and local Host Firewall settings interact.<br>This setting is detailed with the [Set-NetFirewallHyperVVMSetting][PS-2] cmdlet.|
|
||
|
||
### Configure Hyper-V firewall settings
|
||
|
||
To configure Hyper-V firewall, use the [Set-NetFirewallHyperVVMSetting][PS-2] command. For example, the following command sets the default inbound connection to *Allow*:
|
||
|
||
```powershell
|
||
Set-NetFirewallHyperVVMSetting -Name '{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}' -DefaultInboundAction Allow
|
||
```
|
||
|
||
### Firewall Rules
|
||
|
||
Hyper-V firewall rules can be enumerated and created from PowerShell. To view rules, use the [Get-NetFirewallHyperVRule][PS-3] cmdlet. For example, to view firewall rules that only pertain to WSL, use the following command:
|
||
|
||
```powershell
|
||
Get-NetFirewallHyperVRule -VMCreatorId '{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}'
|
||
```
|
||
|
||
To configure specific rules, use the [Set-NetFirewallHyperVRule][PS-4] cmdlet.
|
||
|
||
For example, to create an inbound rule to allow TCP traffic to WSL on port 80, use the following command:
|
||
|
||
```powershell
|
||
New-NetFirewallHyperVRule -Name MyWebServer -DisplayName "My Web Server" -Direction Inbound -VMCreatorId '{40E0AC32-46A5-438A-A0B2-2B479E8F2E90}' -Protocol TCP -LocalPorts 80
|
||
```
|
||
|
||
### Target Hyper-V firewall rules and settings to specific profiles
|
||
|
||
Hyper-V firewall rules and settings can be targeted to the *Firewall profiles*, which are based on the type of network the device is connected to:
|
||
|
||
- Public profile
|
||
- Private profile
|
||
- Domain profile
|
||
|
||
The policy options are similar to the ones already described, but are applied to specific profiles for the connected Windows Host network adapter.
|
||
|
||
To view the settings per profile, use the following command:
|
||
|
||
```powershell
|
||
Get-NetFirewallHyperVProfile -PolicyStore ActiveStore
|
||
```
|
||
|
||
> [!NOTE]
|
||
> `-PolicyStore ActiveStore` returns the *applied* settings.
|
||
|
||
The output contains an extra value compared to the ones described in the previous section:
|
||
|
||
| Value | Description |
|
||
|--|--|
|
||
| `AllowLocalFirewallRules` (True/False)| This setting determines how enterprise Hyper-V firewall rules (CSP or GPO) interact with the locally defined Hyper-V firewall rules:<br>- if the value is *True*, both the enterprise Hyper-V firewall rules and the locally defined rules are applied<br>- if the value is *False*, the locally defined Hyper-V firewall rules aren't applied, and only enterprise rules are applied. |
|
||
|
||
> [!NOTE]
|
||
> To configure these **settings** per profile, use the [Set-NetFirewallHyperVProfile][PS-5] cmdlet.
|
||
>
|
||
> To configure these **rules** per profile using the [Set-NetFirewallHyperVRule][PS-4] cmdlet with the `-Profile` option.
|
||
|
||
## Configure Hyper-V firewall with CSP
|
||
|
||
You can configure Hyper-V firewall using the [Firewall CSP][CSP-1], for example with an MDM solution like Microsoft Intune.
|
||
|
||
To learn more about the CSP options, follow these links:
|
||
|
||
- [Configure Hyper-V firewall settings][SETTINGS]: to configure the Hyper-V firewall settings
|
||
- [Configure Hyper-V firewall rules][RULE]: to configure list of rules controlling traffic through the Hyper-V firewall
|
||
|
||
To learn how to configure the firewall with Microsoft Intune, see [Firewall policy for endpoint security][INT-1].
|
||
|
||
### :::image type="icon" source="../../../images/icons/feedback.svg" border="false"::: Provide feedback
|
||
|
||
To provide feedback for Hyper-V firewall, open [**Feedback Hub**][FHUB] and use the category **Security and Privacy > Microsoft Defender Firewall and network protection**.
|
||
|
||
<!--links used in this document-->
|
||
|
||
[CSP-1]: /windows/client-management/mdm/firewall-csp
|
||
|
||
[FHUB]: feedback-hub://?tabid=2&newFeedback=true&feedbackType=1
|
||
[INT-1]: /mem/intune/protect/endpoint-security-firewall-policy
|
||
[PS-1]: /powershell/module/netsecurity/get-netfirewallhypervvmsetting
|
||
[PS-2]: /powershell/module/netsecurity/set-netfirewallhypervvmsetting
|
||
[PS-3]: /powershell/module/netsecurity/get-netfirewallhypervrule
|
||
[PS-4]: /powershell/module/netsecurity/set-netfirewallhypervrule
|
||
[PS-5]: /powershell/module/netsecurity/set-netfirewallhypervprofile
|
||
|
||
[RULE]: /windows/client-management/mdm/firewall-csp#mdmstorehypervfirewallrules
|
||
[SETTINGS]: /windows/client-management/mdm/firewall-csp#mdmstorehypervvmsettings
|